PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco020108.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family ARF
Protein Properties Length: 687aa    MW: 76935.2 Da    PI: 6.1197
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco020108.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3741.8e-23114214198
                  EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                  f+k+lt sd++++g +++ +++a+e+     +++++ +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD ++F   + +++el+
  Aco020108.1 114 FCKILTASDTSTHGGFSVLRRHATEClplldMSQPTPTQELVAKDLHGFEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFIFL--RGENGELR 209
                  99*****************************77777888*************************************************..449999** PP

                  EEEE- CS
           B3  94 vkvfr 98 
                  v+++r
  Aco020108.1 210 VGIRR 214
                  ***98 PP

2Auxin_resp95.96e-32240319183
   Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                  a+ha++t++ F+v+Y+Pr+  s+F+++++k+++a k+ + vG Rfkm+fe++d++e+++sGt+vgv dl++ +W++S+WrsLk
  Aco020108.1 240 ASHAVATHTLFTVFYKPRT--SQFIISLNKYLEAAKSGFVVGVRFKMRFEGDDVPEKNFSGTIVGVGDLSS-QWKDSEWRSLK 319
                  789***************6..9**********************************************777.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.6E-39106229IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.42E-40106243IPR015300DNA-binding pseudobarrel domain
CDDcd100171.93E-20112214No hitNo description
PfamPF023621.3E-21114214IPR003340B3 DNA binding domain
PROSITE profilePS5086312.026114216IPR003340B3 DNA binding domain
SMARTSM010197.4E-22114216IPR003340B3 DNA binding domain
PfamPF065074.8E-30240319IPR010525Auxin response factor
PfamPF023099.6E-11553653IPR033389AUX/IAA domain
SuperFamilySSF542773.63E-12560639No hitNo description
PROSITE profilePS5174526.938563655IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 687 aa     Download sequence    Send to blast
MASGGGEELF EELWRACAGP LVEVPRVGER VFYFPQGHME QLEASTNQEL DQQIPLFNLP  60
YKILCRVMNI QLRAEPETDE VYAQITLQPE ADDNAPGSPD PCPPEQARPA VHSFCKILTA  120
SDTSTHGGFS VLRRHATECL PLLDMSQPTP TQELVAKDLH GFEWRFKHIF RGQPRRHLLT  180
TGWSTFVTSK RLVAGDAFIF LRGENGELRV GIRRLARQQS TIPASVISSQ TMHLGVLATA  240
SHAVATHTLF TVFYKPRTSQ FIISLNKYLE AAKSGFVVGV RFKMRFEGDD VPEKNFSGTI  300
VGVGDLSSQW KDSEWRSLKV QWDEPANIHR PEKVSPWELE PFNATTAPVL SAPQPVLSKN  360
KRPRQPTDIS ELQMIGVEQN QPFWYSGYTQ SHDLTALSST ENKANTVTKN GASSLDPVVR  420
DNWLKDFHSP MKSPASSLTD VSLKLFHDRN EETVVASTDY MTEEPMLKLC TGIEEQKKPE  480
SVSGGCRLFG INLVSPVKST SEKPNLAPVC TSVAAVKDPS SKGTGSIEDL DRQSALSKVS  540
KELKQGIQEI PKEIQSRQNC SIRSRTKVQM QGIAVGRAVD LTVLDGYDEL ISELELMFEI  600
QGELQRRDKW QVVFTDDEGD MMLVGDDHWQ EFCKMAKKIF IYTSEEVKKM MPRRKFPSLP  660
ANEGEEARTR TRTTAPLHQE ELKDEA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-177734617359Auxin response factor 1
4ldw_A1e-177734617359Auxin response factor 1
4ldw_B1e-177734617359Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010915982.10.0PREDICTED: auxin response factor 9-like
SwissprotQ5NB850.0ARFA_ORYSJ; Auxin response factor 1
TrEMBLM0S9G70.0M0S9G7_MUSAM; Auxin response factor
STRINGGSMUA_Achr2P19760_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP108236116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9